Ranking Alexa Global: # 17,430,837
Server:Apache...
The main IP address: 198.46.224.103,Your server United States,Chicago ISP:ColoCrossing TLD:com CountryCode:US
The description :shortaz — is a short url service. with the help of shortaz.com you can transform a long url info into a short one....
This report updates in 28-Sep-2018
Created Date: | 2016-12-17 |
Changed Date: | 2017-11-26 |
Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service found where is host shortaz.com. Currently, hosted in United States and its service provider is ColoCrossing .
Latitude: | 41.850028991699 |
Longitude: | -87.650047302246 |
Country: | United States (US) |
City: | Chicago |
Region: | Illinois |
ISP: | ColoCrossing |
HTTP Header information is a part of HTTP protocol that a user's browser sends to called Apache containing the details of what the browser wants and will accept back from the web server.
Content-Encoding: | gzip |
Transfer-Encoding: | chunked |
Set-Cookie: | PHPSESSID=2n9mdph0j32tjqle4nudbin9h3; path=/, background=1; expires=Sat, 29-Sep-2018 00:33:53 GMT |
Expires: | Thu, 19 Nov 1981 08:52:00 GMT |
Vary: | Accept-Encoding |
Keep-Alive: | timeout=5, max=100 |
Server: | Apache |
Connection: | Keep-Alive |
Pragma: | no-cache |
Cache-Control: | no-store, no-cache, must-revalidate, post-check=0, pre-check=0 |
Date: | Fri, 28 Sep 2018 00:33:53 GMT |
Content-Type: | text/html; charset=UTF-8 |
soa: | ns1.dnsowl.com. hostmaster.dnsowl.com. 1538094751 7200 1800 1209600 600 |
ns: | ns1.dnsowl.com. ns2.dnsowl.com. ns3.dnsowl.com. |
ipv4: | IP:198.46.224.103 ASN:36352 OWNER:AS-COLOCROSSING - ColoCrossing, US Country:US |
home login get started english español deutsch pусский português francais thai × login to your account remember me login forgot password click here to reset your password. don't have an account yet ? create an account forget password ? enter your e-mail address below to reset your password. reset password (back to login) home login get started english español deutsch pусский português francais thai x shorten copy advanced options geotargeting afghanistan aland islands albania algeria american samoa andorra angola anguilla antarctica antigua and barbuda argentina armenia aruba australia austria azerbaijan bahamas bahrain bangladesh barbados belarus belgium belize benin bermuda bhutan bolivia bosnia and herzegovina botswana bouvet island brazil british indian ocean territory brunei darussalam bulgaria burkina faso burundi cambodia cameroon canada cape verde cayman islands central african republic chad chile china christmas island cocos (keeling) islands colombia comoros congo congo, democratic republic cook islands costa rica cote d'ivoire croatia cuba cyprus czech republic denmark djibouti dominica dominican republic ecuador egypt el salvador equatorial guinea eritrea estonia ethiopia falkland islands (malvinas) faroe islands fiji finland france french guiana french polynesia french southern territories gabon gambia georgia germany ghana gibraltar greece greenland grenada guadeloupe guam guatemala guernsey guinea guinea-bissau guyana haiti heard island & mcdonald islands holy see (vatican city state) honduras hong kong hungary iceland india indonesia iran, islamic republic of iraq ireland isle of man israel italy jamaica japan jersey jordan kazakhstan kenya kiribati korea kuwait kyrgyzstan lao people's democratic republic latvia lebanon lesotho liberia libyan arab jamahiriya liechtenstein lithuania luxembourg macao macedonia madagascar malawi malaysia maldives mali malta marshall islands martinique mauritania mauritius mayotte mexico micronesia, federated states of moldova monaco mongolia montenegro montserrat morocco mozambique myanmar namibia nauru nepal netherlands netherlands antilles new caledonia new zealand nicaragua niger nigeria niue norfolk island northern mariana islands norway oman pakistan palau palestinian territory, occupied panama papua new guinea paraguay peru philippines pitcairn poland portugal puerto rico qatar reunion romania russian federation rwanda saint barthelemy saint helena saint kitts and nevis saint lucia saint martin saint pierre and miquelon saint vincent and grenadines samoa san marino sao tome and principe saudi arabia senegal serbia seychelles sierra leone singapore slovakia slovenia solomon islands somalia south africa south georgia and sandwich isl. spain sri lanka sudan suriname svalbard and jan mayen swaziland sweden switzerland syrian arab republic taiwan tajikistan tanzania thailand timor-leste togo tokelau tonga trinidad and tobago tunisia turkey turkmenistan turks and caicos islands tuvalu uganda ukraine united arab emirates united kingdom united states united states outlying islands uruguay uzbekistan vanuatu venezuela viet nam virgin islands, british virgin islands, u.s. wallis and futuna western sahara yemen zambia zimbabwe our awesome features password protect set a password to protect your links from unauthorized access. custom alias your link can instantly have a cool and memorable address by adding custom alias. bundle bundle your links for easy access and share them with the public on your public profile. share share your links in one click via the dashboard. complete analytics track each and every user who clicks a link. geotarget geotarget your links to redirect visitors to specialized pages and increase your conversion. developer api shorten urls from your site using an api. export urls you can export your urls along with a summary of the stats as csv. links shortened 0 urls created 0 clicks served 0 users registered your last 10 urls latest public urls top 10 public urls no urls found... latest public urls short link clicks user profile cosl drilling is the international branch of cosl china for the jack-up division and operates a fleet of 8 high specification jack-ups. saudoljky 0 통역 견적 문의 - car workshop manuals a... other common types of faucets include ball faucets (common single faucet kitchen sink style), disc faucets (common shower style) and cartridge faucets... ebookservicemanualsforsuv99114 0 propranolol cost 75g1j un italianissimo locale dall'animo argentino rwjstikad 0 user profile pbomhttsbg 0 doerle cosplay cosplaycostumes88559 0 elimite | buy cod check tameside | russialaw.... tlqnelgrumiq 0 order lamictal cash orders architettura e ingegneria: studio consani opera nella progettazione di edifici, direzione lavori, ristrutturazioni e restauri di fabbricati, consulenz... shbdpkrlyjmgkxreo 0 vasotec | to buy hypertension discounts | g-g... qoaykuktncrnawx 0 my profile sigxnyczx 0 user profile apc direct pvmzktxwkpemajowgq 0 dermavix cream | anti-wrinkle formula | benef... dermavix cream uses peptides & whole collagen molecules to combat signs like wrinkles, fine lines & dark circles. read review on this ... dermavixcream9319 0 bee cosplay cosplaycostumes72371 0 cefixime | price | халява в интер... халява в интернете. бесплатные программы, сервисы интернета, торрент-трекеры, пои qijyhpwvl 0 cipro | buy generic us | avtorshop сайт ... eotnhsnvtyhqhviegu 0 the good fight season 1 dvd boxset freeshippi... buy the good fight season 1 dvd box set available that can play on region 1, 2, 4 player at tvdvdstore.com with only $24.99 ! watchdarkmatter11250 1 kitty cosplay cosplaycostumes49993 0 where to buy sinequan insomnia fmdgopelnmeumb 0 http://www.caramela.ru/bitrix/rk.php?goto=htt... httpwwwatpusijatengoridhalkomentar-144-4455html74594 0 yönlendiriliyorsunuz.. marykaytimewisereplenishingserumctestimoni9062 0 elitek building design | ruurlo & zu... elitek building design | ruurlo & zutphen wjyjthxwcxld 0 testimoni dan review set serum melacep mary k... mary kay melacep serum sunblock terbaik di malaysia- cara memutihkan kulit muka, menghilangkan parut, jeragat di muka dan meratakan tona wajah. carameratakantonakulitmuka74071 0 marquita - advair diskus | purchase cheap bra... looking for a advair diskus? not a problem! buy advair diskus online ==> http://newcenturyera.com/med/advair diskus ---- guaranteed worldwide s... mecabtgoiyzxn 0 catalin chiru - australia buy online zestoret... jpoquxbtsulcwqj 0 http://brisbanestudentshome.com/guestbook.php pengalamanbisnesmarykay1662 0 activity feed bdtjwwzm 0 top 10 public urls short link clicks second amendment news | outdoor adventure usa cheapconvictiondvd66924 5405 imgspice - free image hosting, image sharing ... imgspice - free image hosting, image sharing & earn money xxf3n 3377 picchan.org gac64 2049 this is a downloadable file. please note that this short url is linked to a downloadable file. pugsu 1968 özel video xdo3u 1098 http://[email protected].... mukacantiktapisayangnyarasulullahmeaningofcolors15255 988 http://anobufefig.com/in.htm?wm=257718582 0dzja 958 https://selly.gg/p/7991acbf bea 708 https://selly.gg/p/15feb340 nudes 654 history of bulgaria : every year - youtube jyqux 633 2018 © terms and conditions buyer protection dmca report privacy policy contact
http://www.shortaz.com/?lang=th
http://www.shortaz.com/#aaa
http://www.shortaz.com/?lang=ru
http://www.shortaz.com/?lang=es
http://www.shortaz.com/#forgot
http://www.shortaz.com/#copy
http://www.shortaz.com/#bbb
http://www.shortaz.com/?lang=fr
http://www.shortaz.com/?lang=en
http://www.shortaz.com/#lang
http://www.shortaz.com/?lang=po
http://www.shortaz.com/#ccc
http://www.shortaz.com/?lang=de
http://www.shortaz.com/#body
Whois is a protocol that is access to registering information. You can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations. In a nutshell, it includes these informations;
Domain Name: SHORTAZ.COM
Registry Domain ID: 2082629496_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.namesilo.com
Registrar URL: http://www.namesilo.com
Updated Date: 2017-11-26T04:03:09Z
Creation Date: 2016-12-17T04:39:51Z
Registry Expiry Date: 2018-12-17T04:39:51Z
Registrar: NameSilo, LLC
Registrar IANA ID: 1479
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.4805240066
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.DNSOWL.COM
Name Server: NS2.DNSOWL.COM
Name Server: NS3.DNSOWL.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-10-13T22:18:46Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.
TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.
The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.
REGISTRAR NameSilo, LLC
SERVERS
SERVER com.whois-servers.net
ARGS domain =shortaz.com
PORT 43
TYPE domain
DOMAIN
NAME shortaz.com
CHANGED 2017-11-26
CREATED 2016-12-17
STATUS
clientTransferProhibited https://icann.org/epp#clientTransferProhibited
NSERVER
NS1.DNSOWL.COM 173.254.242.221
NS2.DNSOWL.COM 104.225.253.5
NS3.DNSOWL.COM 209.141.39.150
REGISTERED yes
The following list shows you to spelling mistakes possible of the internet users for the website searched .